NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211726_10088544

Scaffold Ga0211726_10088544


Overview

Basic Information
Taxon OID3300020161 Open in IMG/M
Scaffold IDGa0211726_10088544 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1343
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)14 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000369Metagenome / Metatranscriptome1222Y
F013888Metagenome / Metatranscriptome267Y

Sequences

Protein IDFamilyRBSSequence
Ga0211726_100885441F013888N/ADEVRVSTRPEWIPIIQNMDMNIKLIVKEPSTMSDAIKFMIGDYNDTVLVGMPDTYILNAPSNIYKEMMKETNADLVLGIWECLGELKGRVGQVMVSSSGKVLESKDKVSDCDYKDMWGTMLFRKNMIRYIDPSLDHPGKQIQEWIDEGSNIQSVRPGGRYMDIGTLRGLKQLYKEMDV
Ga0211726_100885443F000369GAGMSEIELADHFDRMNVVVSELLKGNNPTQIATVTGFKRAEVVELIDEWKSVVHNDTAARERAKEAISGADQHYAMLIKEAWKTVEDADQAGQLNVKSGALKLIADIEGKRIGMLQEVGLLDNAELANQIAETERKQDILVKILKEVTASCP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.