NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194037_1041747

Scaffold Ga0194037_1041747


Overview

Basic Information
Taxon OID3300020164 Open in IMG/M
Scaffold IDGa0194037_1041747 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L304-6m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1798
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.659Long. (o)-93.748Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001754Metagenome / Metatranscriptome641Y
F003291Metagenome / Metatranscriptome495Y
F007113Metagenome / Metatranscriptome357Y

Sequences

Protein IDFamilyRBSSequence
Ga0194037_10417471F001754N/AMSTVYNNFAASKMSNNPRFEVVVSFKDFLGKTHNIVCKNRKKLAEANEFLKMFKTESVKINSILSEYPVVLGKFPKKYHSEIKRELATAGFSTVANFLIGK
Ga0194037_10417472F003291N/AMNQNEKLVSVFTQDELAALMTAMAGYVNVKRKQGRSTGIESVVFNKVCDALLLSNYLNAEEIEVKADSNAPMGSAAYKAYEAMYESDVRAHS
Ga0194037_10417473F007113N/AMKLELTPEQLKTVEIALTELFNSDTWTNGRKEADIDKIAVGAAYLLHVIESYNKNNKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.