NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179594_10008484

Scaffold Ga0179594_10008484


Overview

Basic Information
Taxon OID3300020170 Open in IMG/M
Scaffold IDGa0179594_10008484 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2767
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003589Metagenome478Y
F018890Metagenome / Metatranscriptome232Y

Sequences

Protein IDFamilyRBSSequence
Ga0179594_100084841F003589N/ADATLDDGKLQEVARRLGARAADRLDVERTAQAVVTRLRTEPRADIRVLGSIRPAWLRIAAALVMVVGAGVVALNVRVPLFTTPVPPATASGELSELSGDELRAVLEAVGQPGGEQQEVSPQDLSLEDLSAPQLRALLKSLEG
Ga0179594_100084844F018890GGAGGMFGIPDWAVGVAFITLAISIGKALAGRIGPPDRLRGPRGSRRDLAQAVDELQKRVGGSEDVLARLDALEDVQRRLADVEERLDFAERILAKQRDAERIAPPKS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.