NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0179594_10079577

Scaffold Ga0179594_10079577


Overview

Basic Information
Taxon OID3300020170 Open in IMG/M
Scaffold IDGa0179594_10079577 Open in IMG/M
Source Dataset NameVadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1153
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil → Vadose Zone Soil And Rhizosphere Microbial Communities From The Eel River Critical Zone Observatory, Northern California To Study Diel Carbon Cycling

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)39.7291Long. (o)-123.6419Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062085Metagenome / Metatranscriptome131Y
F074441Metagenome / Metatranscriptome119Y
F084681Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0179594_100795771F062085N/ASYTGSIMEKLQAFQAAACEGGFVAIKESEEDTVLWLKKATAEAEDRICLDSLTNSATVYWATIPWKINSKTFREASALRAWILSRPGVLAS
Ga0179594_100795772F074441N/AMTNHEALLRLSVDKNDHLAVTSLHENNAEIIRTTVMRYFGSGTAAENVEFELMKRMADHARLYEDSEDLDVWLACCANTECDRMRNEAIRDKANRD
Ga0179594_100795773F084681AGGAGMATLEHRITPRFKLNTRLSFHRMKTLSEGEHQARAINISTRGVYFATNVILCVGEALEVLLEMPKRVTGVKAGIRRFAGRVTHIESTNMLPGLSGIGVQLLYYERDLAGIPKPKVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.