NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211729_10160307

Scaffold Ga0211729_10160307


Overview

Basic Information
Taxon OID3300020172 Open in IMG/M
Scaffold IDGa0211729_10160307 Open in IMG/M
Source Dataset NameFreshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterSciLifeLab
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1696
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Lake Microbial Communities From Lake Erken, Sweden

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.83763399Long. (o)18.6203826Alt. (m)Depth (m)0 to 20
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000450Metagenome / Metatranscriptome1126Y
F006984Metagenome / Metatranscriptome360Y
F007470Metagenome / Metatranscriptome350Y

Sequences

Protein IDFamilyRBSSequence
Ga0211729_101603073F007470GGAGMDYQDGFQDGVKFAREVIITNIRLWAETSDDGPAYDDIADRLEFGTVDYDL
Ga0211729_101603075F000450GGCGGMGDRANFGFVQPNGNTIVLYGHWAGHQMLANLAEAVFKARARWGDSSYATRIAISQMVADDWSSETGWGLHVNEIGDNEHKIAIIDFDQQTFSLHEEAPRNDKDNKVNGMSNDALFTMDLSNFVEKYADVTLSV
Ga0211729_101603076F006984AGGAMPNWCYNTLTIQGPKSEVDMIKDRLNKPFTLAQETYGMGDINAHGFPTKIKEVTYSNPVFAFFNIHSYKDEGITDEEYACQP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.