NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194134_10111523

Scaffold Ga0194134_10111523


Overview

Basic Information
Taxon OID3300020179 Open in IMG/M
Scaffold IDGa0194134_10111523 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1314
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (20.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-4.8915Long. (o)29.586Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000345Metagenome / Metatranscriptome1253Y
F010525Metagenome / Metatranscriptome302Y

Sequences

Protein IDFamilyRBSSequence
Ga0194134_101115231F010525N/ALEMLKFLAPFAGALCMENFVYRQGELCNIRDYPANVVKYDKQNPKDACYKDGIFYPRCKDLDNPEVLHYHNLLYGQK
Ga0194134_101115234F000345AGGAGLELFLEKMTESKNLGKSLQEWWDSDAFKEFQKINEETKQRAVGKYFMLSESDKLDMVQAICYIICKAEEEGTSHRGLQDALGIYPAGFWVDHLMDVHNALWAYYHDKTKEKELKDDLDTLDDFLNSGGIN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.