NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194115_10024030

Scaffold Ga0194115_10024030


Overview

Basic Information
Taxon OID3300020183 Open in IMG/M
Scaffold IDGa0194115_10024030 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4578
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Lake Tanganyika, Tanzania

Source Dataset Sampling Location
Location NameTanzania: Lake Tanganyika
CoordinatesLat. (o)-6.4446Long. (o)29.9042Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F084138Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0194115_1002403011F084138AGGAMANQVTVLEEIVGDVAIALYQKWYNAMPAEENNEVAEKALKKNAQETTLFVIQMFMDKFNQAAEELKNKD
Ga0194115_100240303F000473AGGAGVSLNNSQHFYDNNHFKYGINQWTGEPNKPVFYSEEMKKKIREIKRPMLLLMDIAMYPDFLTIRLYEDNFLQFDGSKKEEVIAYVEKVKKIIESFGVRCELEGVPSARVL
Ga0194115_100240305F000671GAGGMDKILCYSCNKSKHKLNAKKSSLLPINLLMCETCVNSKLEPRWVIILAGRSQGADYVREFVLKKRYLGDEISASELLV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.