NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0206131_10082479

Scaffold Ga0206131_10082479


Overview

Basic Information
Taxon OID3300020185 Open in IMG/M
Scaffold IDGa0206131_10082479 Open in IMG/M
Source Dataset NamePelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1932
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → environmental samples → uncultured marine virus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater → Pelagic Marine Microbial Communities From North Sea

Source Dataset Sampling Location
Location NameAtlantic Ocean: North Sea, Helgoland
CoordinatesLat. (o)54.1841Long. (o)7.9Alt. (m)Depth (m)1
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018266Metagenome / Metatranscriptome236N
F042572Metagenome / Metatranscriptome158Y
F050676Metagenome / Metatranscriptome145N

Sequences

Protein IDFamilyRBSSequence
Ga0206131_100824791F050676AGGAGGMQTKLPVKSRVADKYQPMLTYYAELIGLCHETVTKTESLKMLDPMGKKTTATSLFIRICQRMDKSIDAKEIADKLENVSQINNQKEIA
Ga0206131_100824795F018266GAGGMFRVIIEGKFRENPINLSRAVKLLYNQDFTGSIRKENILWWKKYFLKVIHLPILYPKMGYIQIVKVYRDKKPSIRVVTVPTSSDKRELLVLNKIYGGDNG
Ga0206131_100824797F042572AGGMMLINLVYQEIDRRKMSRNLIVYKVEYKNQSDPWCGRKFIKTKRIVMTPDEVNQTDGYWRNHRNVRNKFYKQMGDNYSVWSVKKA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.