Scaffold Ga0163153_10045091

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163153_10045091

Scaffold Ga0163153_10045091

Overview

Basic Information
Taxon OID	3300020186 Open in IMG/M
Scaffold ID	Ga0163153_10045091 Open in IMG/M
Source Dataset Name	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3078
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Pirellulales → Pirellulaceae → Blastopirellula → Blastopirellula marina	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Lake Vanda, McMurdo Dry Valleys
Coordinates	Lat. (^o)	-77.5281	Long. (^o)	161.59	Alt. (m)		Depth (m)	19
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003850	Metagenome / Metatranscriptome	465	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163153_100450913	F003850	GGAGG	MTYPPTYHLQDLGSQAQTMSRNCGNERTAMVMQYVAIGCMIVMAGVAASQVLKDAFGDHHPGRGRSR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.