Scaffold Ga0163153_10089784

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0163153_10089784

Scaffold Ga0163153_10089784

Overview

Basic Information
Taxon OID	3300020186 Open in IMG/M
Scaffold ID	Ga0163153_10089784 Open in IMG/M
Source Dataset Name	Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP6.IB-1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1871
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat → Freshwater Microbial Mat Bacterial Communities From Lake Vanda, Mcmurdo Dry Valleys, Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Lake Vanda, McMurdo Dry Valleys
Coordinates	Lat. (^o)	-77.5281	Long. (^o)	161.59	Alt. (m)		Depth (m)	19
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071395	Metagenome	122	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0163153_100897841	F071395	N/A	SSSKIRFTTKKDIVFFIKTSGDVIDLTSYIKLYQFVPVDQKREVTVTSKEGMLNDKDEAKGKLMSFSVKMISKDNYQLQLPEQLEAGEYGFVWVKNMELKEFTVFAFGIDWKNID

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.