Scaffold Ga0196964_10062431

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0196964_10062431

Scaffold Ga0196964_10062431

Overview

Basic Information
Taxon OID	3300020202 Open in IMG/M
Scaffold ID	Ga0196964_10062431 Open in IMG/M
Source Dataset Name	Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1589
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Systems Level Insights Into Methane Cycling In Arid And Semi-Arid Ecosystems

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	33.3049	Long. (^o)	-116.2547	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094375	Metagenome	106	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0196964_100624312	F094375	GAG	VRTALALALLVLCAGVHAQQYRYNVPREVHCEAHPYCGQPGRSCKGVEKTYRGSAAGSAKHSIVQECVQANRPDRCNCVQQCRQVARCSKA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.