Scaffold Ga0212227_1150169

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212227_1150169

Scaffold Ga0212227_1150169

Overview

Basic Information
Taxon OID	3300020234 Open in IMG/M
Scaffold ID	Ga0212227_1150169 Open in IMG/M
Source Dataset Name	Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	JGI facility at Oak Ridge National Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1221
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment → Deep-Sea Sediment Microbial Communities From The Pacific Ocean Trenches

Source Dataset Sampling Location
Location Name	Kermadec Trench, Pacific Ocean
Coordinates	Lat. (^o)	-34.34030667	Long. (^o)	-178.1757117	Alt. (m)		Depth (m)	8081
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F078729	Metagenome / Metatranscriptome	116	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212227_11501691	F078729	N/A	DETRRLLKVFGVAVTDFETEAEKLAANAARVAGASGKEEIAKLLKDTTELCRELNTRWLETTQHVFAAQNRLLNLCAKAAARLQSEDAITEIESARMEARE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.