Scaffold Ga0211591_1044956

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211591_1044956

Scaffold Ga0211591_1044956

Overview

Basic Information
Taxon OID	3300020280 Open in IMG/M
Scaffold ID	Ga0211591_1044956 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	938
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_125
Coordinates	Lat. (^o)	-8.895	Long. (^o)	-142.6228	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007219	Metagenome	355	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211591_10449561	F007219	N/A	KKEYVECVQPTTGEGVEWEVISRKVTEDAHKQWPDVKSDPYDEIVEIRKKTCYGNPEEVFETFETARYRKYKPVPELPTEVKVEKQKVKQEVKVES

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.