Scaffold Ga0211483_10026817

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211483_10026817

Scaffold Ga0211483_10026817

Overview

Basic Information
Taxon OID	3300020281 Open in IMG/M
Scaffold ID	Ga0211483_10026817 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_A100001035 (ERX556022-ERR599116)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1904
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (83.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_032
Coordinates	Lat. (^o)	23.4017	Long. (^o)	37.2183	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047073	Metagenome / Metatranscriptome	150	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211483_100268175	F047073	N/A	VVTFDQIGKNVQNSWKDFMAFINESPLGVALKVFGATGLTWVVDNIGDFGWPPILVVAIPPALVVLVDWLNKQNPRFGRQDG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.