Basic Information | |
---|---|
Taxon OID | 3300020300 Open in IMG/M |
Scaffold ID | Ga0211662_1021987 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000959 (ERX555977-ERR598981) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1276 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_100 | |||||||
Coordinates | Lat. (o) | -12.9057 | Long. (o) | -96.155 | Alt. (m) | Depth (m) | 177 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F075324 | Metagenome | 119 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211662_10219872 | F075324 | N/A | VNAGLSHKKTRIQLELKQVVSLAVFLLRPQADFKSAHLLKIVNILPNVNYLEAFYLINLR |
⦗Top⦘ |