Scaffold Ga0211600_1023414

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211600_1023414

Scaffold Ga0211600_1023414

Overview

Basic Information
Taxon OID	3300020348 Open in IMG/M
Scaffold ID	Ga0211600_1023414 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000676 (ERX556089-ERR599161)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1664
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_124
Coordinates	Lat. (^o)	-9.067	Long. (^o)	-140.6346	Alt. (m)		Depth (m)	120
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102861	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211600_10234142	F102861	N/A	LERIDYKSSGPYNSILSGTFDPFEVGWNLVRRLSLEAVKRREKIVRNIFLCIIFVVGLTFTEASKANDCVVTDWKISAKVQNKKPLDVRNTFTVKDSRVSAYVRINCTQPVQNTEFCFYRNKAKYACVKLPVKSPEHWRTWASVKALKGSWMVRLRIDEREMLTDKFLVQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.