Scaffold Ga0211682_10378506

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211682_10378506

Scaffold Ga0211682_10378506

Overview

Basic Information
Taxon OID	3300020376 Open in IMG/M
Scaffold ID	Ga0211682_10378506 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	518
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_085
Coordinates	Lat. (^o)	-62.2658	Long. (^o)	-49.1658	Alt. (m)		Depth (m)	90
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089417	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211682_103785062	F089417	N/A	GNSMKSGFKTKSPVDGIIIDMILDHYNMQSMSGHPESLTGENFNDICKEAETIYYKTILITKRPGVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.