NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211647_10061987

Scaffold Ga0211647_10061987


Overview

Basic Information
Taxon OID3300020377 Open in IMG/M
Scaffold IDGa0211647_10061987 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1346
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_109
CoordinatesLat. (o)2.0663Long. (o)-84.5304Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005433Metagenome / Metatranscriptome401Y
F022758Metagenome / Metatranscriptome213Y

Sequences

Protein IDFamilyRBSSequence
Ga0211647_100619872F022758AGGAGMSSLPATGATISIGTVRDYFGLSGTTSLLDLGQFISPQVTTSISLSATFGGWQNPNSTGASP
Ga0211647_100619873F005433AGGAGMSIRTRFEIETFMLGSHSTMERKAQAIKMELEQAQASNHPDLPVIQAIYDDFAKDNDVDALIANIEETEEQYWVDRLARMAAIDILTIGKVQPEHMQYMSSLKDDAFEACVKSAVALAKSLNESVREIEAELGTDILED

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.