NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211647_10157256

Scaffold Ga0211647_10157256


Overview

Basic Information
Taxon OID3300020377 Open in IMG/M
Scaffold IDGa0211647_10157256 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)750
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_109
CoordinatesLat. (o)2.0663Long. (o)-84.5304Alt. (m)Depth (m)30
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004236Metagenome / Metatranscriptome447Y
F026306Metagenome / Metatranscriptome198Y

Sequences

Protein IDFamilyRBSSequence
Ga0211647_101572562F026306AGGAMARETKRGGEKNDGQDLEMEKFLEELSNNTPNGDQFKGEEDE
Ga0211647_101572563F004236GGAMSKSFRQFKKGDFGLREAKASTTHLQYLRAKQAGNNHFEVRRYIADKILNDRKLADAYKSLETIHDTYGRHIGNDAIQLRQRLENMLKQDVKRKVLNWDEVWSTL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.