Scaffold Ga0211678_10439839

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211678_10439839

Scaffold Ga0211678_10439839

Overview

Basic Information
Taxon OID	3300020388 Open in IMG/M
Scaffold ID	Ga0211678_10439839 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	512
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED239	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_093
Coordinates	Lat. (^o)	-33.8785	Long. (^o)	-73.0369	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004055	Metagenome / Metatranscriptome	455	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211678_104398392	F004055	GAG	MEMELKQKIPKLHKTTNPKHREDYVFVEKPGEDFTALKLISGPFSSIVYKYGAVGFRPESEKRPDGTLPMQFDYDIIENKIDADIDSQEFINHIGDILVVLLDEKLKEDKLNAKN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.