Scaffold Ga0211583_10076059

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211583_10076059

Scaffold Ga0211583_10076059

Overview

Basic Information
Taxon OID	3300020397 Open in IMG/M
Scaffold ID	Ga0211583_10076059 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1281
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Candidatus Endolissoclinum → unclassified Candidatus Endolissoclinum → Candidatus Endolissoclinum sp. TMED37	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_042
Coordinates	Lat. (^o)	6.0124	Long. (^o)	73.8985	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002077	Metagenome / Metatranscriptome	596	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211583_100760592	F002077	GAG	VTNLLPKQTKKEREITPQQEQFLENLFDNGGNVTDAALKAGYAKGSVTWLRNSLADEIIRRTQNVLSMNAFKAATRLVSTIDNPVPERGDDLRFRAAESLLNRVGLGKQETTNVNVQAIHGVVLLPPKKEVVIDGN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.