NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211653_10116185

Scaffold Ga0211653_10116185


Overview

Basic Information
Taxon OID3300020421 Open in IMG/M
Scaffold IDGa0211653_10116185 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1187
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_102
CoordinatesLat. (o)-5.2476Long. (o)-85.3343Alt. (m)Depth (m)40
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000613Metagenome / Metatranscriptome985Y
F021434Metagenome / Metatranscriptome219Y
F036730Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0211653_101161851F036730AGGMAEEFTINSAAIETKINQLLPSQGGFQPGIDFSASTMVIPIVDLTETAEGSSLRQDLQT
Ga0211653_101161852F000613AGGAGMPIVKKKVSVAAGATSDQILAGTTYEYVDQGTRIVVAAAVDTAGTATADTTMDFTVNNAEFAKDASVSTLVTGQPFGWNNTGYVMSDMVTTGAVRNRPVIQFKNGTAGTRTVDVAVFIGN
Ga0211653_101161853F021434N/AVATQNAGFGSGFGSFLTDVGRNILSPIGNIFSSPALTPFITPQSVGQPAQPSQGQQMGQESSRSGTQEAFVGGIPNILGQAAKFLRTPAGQIGTGGAIGLGANLLAPSRSGMRITRKMKSQYRSVLNLAGGNYQVAADMIGVSDDMFIAVMLKRFRNDGPVVTKAALRKTKTTVRRLKNMCDMYDSLRPSATRRRTPMKRASTTLISNK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.