NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211702_10053797

Scaffold Ga0211702_10053797


Overview

Basic Information
Taxon OID3300020422 Open in IMG/M
Scaffold IDGa0211702_10053797 Open in IMG/M
Source Dataset NameMarine prokaryotic communities collected during Tara Oceans survey from station TARA_076 - TARA_B100000513 (ERX555999-ERR599126)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1100
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_076
CoordinatesLat. (o)-21.0073Long. (o)-35.3344Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007722Metagenome / Metatranscriptome346Y
F013311Metagenome / Metatranscriptome272Y
F095250Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0211702_100537971F007722N/ADIGTIKKSIQTLNNRINGLNSPKLNDELLQYAIKKQNNVTDINKQMGG
Ga0211702_100537972F013311GGAGGLAFLGDFGKFFNLGSSKEVLGKAGEAVGSFIGGPQGGQIGRSIGRTVARATDNLAGDSNISPISTADQALEQSAVAVSQRGNVPQETSQNVGITGAPQFEAGVFSLPQAIQGIRSLAPSASKFFSSPGTAVGFGTGVAFGMGENRMSKTRMPTRLIQSRKNKAKVRQLVNFLGIPGASDYLSEQMGINVTEADIVNLLLRTFRNDGAYITKAQVRNLRRTTNKFKTLEKQVKEATSMTRTTRRPAMRRASSTTLIKN
Ga0211702_100537973F095250AGGAGMPLVQKTITLAAGATSDNLLANTNYEFVDGNVRLRVASAVDTAGTSATSDTFLNV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.