NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211620_10090046

Scaffold Ga0211620_10090046


Overview

Basic Information
Taxon OID3300020424 Open in IMG/M
Scaffold IDGa0211620_10090046 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000242 (ERX556056-ERR599138)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1321
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_048
CoordinatesLat. (o)-9.4112Long. (o)66.3281Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001145Metagenome / Metatranscriptome765Y
F001219Metagenome / Metatranscriptome744Y

Sequences

Protein IDFamilyRBSSequence
Ga0211620_100900461F001145N/AMNLNTLSFFLNEEPLIQLNPNILESNVQNIIILLGILIYANNVSFSVTLENRQKEIIQTIENAQKDVVNASNYYYLAEKGFTQSLFWLQSWKMLYEKDKADLVTNKYTMIKKGLEETFETTENLIKNVENKAFISIQRYMIFITA
Ga0211620_100900462F001219N/AMIFPTTIFINKLFDFDLTFVIELGFFITLAIIVTFKFINPISKEIDDRAEFINYNLRKSTILLTFGYEKLSDCISLLTQEINELNRQTKLTRNYCNSNFENEISSIQKENLKILSELKGDLSIKSAFLFSNISGDLNSLTDKFFEKKFQSAP
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.