NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211554_10122562

Scaffold Ga0211554_10122562


Overview

Basic Information
Taxon OID3300020431 Open in IMG/M
Scaffold IDGa0211554_10122562 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1303
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → unclassified Rhodospirillaceae → Rhodospirillaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_145
CoordinatesLat. (o)39.2173Long. (o)-72.0327Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004191Metagenome / Metatranscriptome449Y
F007551Metagenome / Metatranscriptome349Y
F016880Metagenome / Metatranscriptome244Y

Sequences

Protein IDFamilyRBSSequence
Ga0211554_101225622F016880AGGAGMTPQEYNKLREQEIIGQEMADETVKSIQLRKDIMKLALAESATNCTIMCGTLFAKFDVSIHKQMAKNLKTTLQTFFDNRKKNDCHVQMSGTLPDNEYAYDFMPIVDFRHEGIGI
Ga0211554_101225623F007551AGGAGMMKNEEGLITAILTQSVEDARYTGFNKIDLKHKIESINWIMGNDPQFLTYCKLLNIEPSYIQNKVKTYNDTRITSQQKMLLKPIVESLLKQDNYKEKYDTARI
Ga0211554_101225624F004191GGAGMIKFYEIMATIFAVLGVFALVGATGAVETDQWVLALALTVMGTCTMFLSIICQEKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.