NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211539_10003875

Scaffold Ga0211539_10003875


Overview

Basic Information
Taxon OID3300020437 Open in IMG/M
Scaffold IDGa0211539_10003875 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6183
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_041
CoordinatesLat. (o)14.5Long. (o)70.0Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014155Metagenome / Metatranscriptome265Y
F020709Metagenome / Metatranscriptome222Y
F082815Metagenome / Metatranscriptome113Y

Sequences

Protein IDFamilyRBSSequence
Ga0211539_100038757F014155AGGAGMNHKRFKFYHHSTEYYRQLYNSIKQLENSCKDINYTVLPSTINYKRKSKFIKSNSNTNKMHKKVG
Ga0211539_100038758F020709AGGAGMTNIKTQPKTAFGRTLHYVTDPQYAEALYKLTGKKTINDVDIINLQMLGLNVNGVNYVNQLALGV
Ga0211539_100038759F082815N/AMRIFAAIERILLDRWRKIKIALKINKWPLLSLQEQQLQLKKQYLESLFRKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.