NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211576_10000986

Scaffold Ga0211576_10000986


Overview

Basic Information
Taxon OID3300020438 Open in IMG/M
Scaffold IDGa0211576_10000986 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)22593
Total Scaffold Genes34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (79.41%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_133
CoordinatesLat. (o)35.4118Long. (o)-127.7122Alt. (m)Depth (m)45
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044515Metagenome / Metatranscriptome154Y
F047691Metagenome / Metatranscriptome149Y
F047972Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0211576_1000098622F047972GAGMRFVEFSPNMMVDRYVIVLKNLIGRASAKKVPAKMNWAGLNKILKSNDASLMADYEMFKAMYDTSPAIQNLVKNFNADGIELNVPGAQDDETPADGATDAQAAVDATAASAAPQQLAQQ
Ga0211576_1000098627F044515GAGMIFGFLLSVFGLHTEAHNLVYLGISIMAVVCAVWWFWVMFVIKDMFIRVERAADKMVEVKVELVGIKGLIRKLFDRSNDK
Ga0211576_100009868F047691N/AMKCEQGDLAKIIFSLNEKNIGKIVLVDKYIGKFNAGGRFDFRGIACVVPVADHYWWVSGEGLSNMFGDTPKAYIADSWLEPLRPDTQKTSQKEKIPYQEVA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.