Scaffold Ga0211640_10134370

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211640_10134370

Scaffold Ga0211640_10134370

Overview

Basic Information
Taxon OID	3300020465 Open in IMG/M
Scaffold ID	Ga0211640_10134370 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100000579 (ERX556060-ERR598961)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1413
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_111
Coordinates	Lat. (^o)	-16.9687	Long. (^o)	-100.7324	Alt. (m)		Depth (m)	90
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F042010	Metagenome / Metatranscriptome	159	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0211640_101343703	F042010	N/A	GSIGNNERWKTPLGARLSRDDIVEKQKAILGSSSGLVA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.