Basic Information | |
---|---|
Taxon OID | 3300020473 Open in IMG/M |
Scaffold ID | Ga0211625_10010245 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | CEA Genoscope |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 7369 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (55.56%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | TARA_122 | |||||||
Coordinates | Lat. (o) | -8.9632 | Long. (o) | -139.2276 | Alt. (m) | Depth (m) | 115 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029554 | Metagenome | 188 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0211625_100102454 | F029554 | AGGAGG | MSPKMLREIAEDDLTPKRSDKVENSNDFYERLKDPDDGFDYDIESYEVIAEYR |
⦗Top⦘ |