NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211625_10038354

Scaffold Ga0211625_10038354


Overview

Basic Information
Taxon OID3300020473 Open in IMG/M
Scaffold IDGa0211625_10038354 Open in IMG/M
Source Dataset NameMarine microbial communities from Tara Oceans - TARA_B100000700 (ERX555932-ERR598948)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3073
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location NameTARA_122
CoordinatesLat. (o)-8.9632Long. (o)-139.2276Alt. (m)Depth (m)115
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005026Metagenome / Metatranscriptome414Y
F048247Metagenome148Y

Sequences

Protein IDFamilyRBSSequence
Ga0211625_100383542F048247GGAGGMIDRDVIWGFGGTLATFSGSLHEWIGVVAGSLTIVFMSFKIWQEIKKRK
Ga0211625_100383543F005026GGAGGMFELLTLFLTGGGSAAMGSILKGVFGAMTDSRQQKYEMEMAREARNNEFAIEYQKQLNSGPGGAFTRATRRMLALIGMSTLAFITCITTVYPSVPLISTTNITGEGRREFLFGLLSFPAEQAPLVVTTGHIALFQATVVLPMIVGFYFTPGGRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.