NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0211547_10205406

Scaffold Ga0211547_10205406


Overview

Basic Information
Taxon OID3300020474 Open in IMG/M
Scaffold IDGa0211547_10205406 Open in IMG/M
Source Dataset NameMarine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001564 (ERX555957-ERR598976)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCEA Genoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1011
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Virus NIOZ-UU157(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameTARA_151
CoordinatesLat. (o)36.139Long. (o)-28.9598Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F048642Metagenome / Metatranscriptome148Y
F075981Metagenome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0211547_102054061F048642N/AMAFNLQEYILFRTEIKRELTNAEVDTNFQMVANPWETTRLYEKGNIVYHPVIVDDPSTTGEDQVLAWWRANKRTTQGTFVTSEWDIIGGIGTGNINVAGANSFGKINVNSTAATGALQNGTNALVTSTIPNDTFNFIAGQGMELQYNLASKSIVVVNTLASNPGEANVGQNIGQGITQQPIYAGKSGVNLQFRGLD
Ga0211547_102054062F075981N/AGDLCSIQVFLAVSDAYDFTTEYKAIDVSQGLKLTTGSSFDLQRNAGRKVFIDRQKQLIENAVKDYVKYWAELKYIYVTGIYSPCYAVPGWSENTWYLKSFREAFVTSRDTSQFPYSDVKIEEFPPN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.