NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208201_100743

Scaffold Ga0208201_100743


Overview

Basic Information
Taxon OID3300020480 Open in IMG/M
Scaffold IDGa0208201_100743 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 16JUL2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2981
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (10.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008235Metagenome / Metatranscriptome336N
F016959Metagenome / Metatranscriptome243N
F059897Metagenome / Metatranscriptome133N
F079785Metagenome / Metatranscriptome115N

Sequences

Protein IDFamilyRBSSequence
Ga0208201_1007431F079785N/AMKYRIWSKNAQCYTNEPCYPGSSLHCASNYYLDNDGNIVDFVTTI
Ga0208201_1007432F059897N/AMKLYSRKNKEDLFDRFEIDIHFPIFKWGTKPGNEWVNDFPTKYIDIKFDTQLVYRKDVTWTYFDLLFLGFGFTITKQTSY
Ga0208201_1007435F008235N/AMINYLKNLSKKKTEPETTPVEQPKNKYYLAKYRANVSLHITYNQLDTDGYHEYRQYENIESDDNLVFLEQKNKKIKEYQETISNINEQLKDNSSEYIMVQKVFLFKKSDFVNAAIIIKDNDLYESTN
Ga0208201_1007436F016959N/AVKPQWPTLKDRLNHPLKDELTALHQLKQVLPLSKQAQKLYDKLSKKFIQEKD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.