NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208200_100470

Scaffold Ga0208200_100470


Overview

Basic Information
Taxon OID3300020487 Open in IMG/M
Scaffold IDGa0208200_100470 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13AUG2008 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3863
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003643Metagenome / Metatranscriptome475N
F008131Metagenome / Metatranscriptome338Y
F008357Metagenome / Metatranscriptome334Y

Sequences

Protein IDFamilyRBSSequence
Ga0208200_1004702F008131GGAGMSVKRLVPLHAVVLDSDPITGRIGDIYYNNSEEELRYFDGSVWNPVGGAITGILEHIHTYDGAIFSVESIEVPASGVIDGGTP
Ga0208200_1004705F008357AGGAGMAGQKNFEVDQNTTFSFIVEYKDSEGNPIDLDGATAKLQVRDTKGGSKLAFSLTSPNGGIIIDAPNGKLTCKMTPTQTNKLFYPKSSYDLMITDSNLNKTKLIEGFLTLSRSVTI
Ga0208200_1004706F003643N/AMPRNRRIYMTKDLKRNGLVEMQEKILAALASYGRHFLGAAIALYMTGNTDPSDLIKGGIAACLPVILKALNTNEPSFGFTKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.