NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208050_1000366

Scaffold Ga0208050_1000366


Overview

Basic Information
Taxon OID3300020498 Open in IMG/M
Scaffold IDGa0208050_1000366 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7531
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (18.18%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023345Metagenome / Metatranscriptome210N
F041040Metagenome / Metatranscriptome160N
F050320Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0208050_10003663F023345N/AMSKTINENDLGDRMYTGQSFVQGGLGGASSLGTYSSPDVSQNPGSFKYAPSIAGSASDISTPPPEDYDNKSTYDPGQYEKDVQDIKYKVTPDEVLAGLQYELKKMVFKRKDLAKELVVRNLKEDNKYYSKLHMLNIDDDDKLPVKPSFMSPESKAEPYNLKATPQQEAVDYRTPQEKEIAKIIREMAQKKYEKRFPKA
Ga0208050_10003664F041040N/AMLLKNRICILFLHYLNDDITIKHYELLKKYNPTKNIYPIGFENHNLIDGSHVVCKKESYPKNDILNKTCEKEYWSEADLLIYDFYLNYPNLPVYFVVEWDTYCNCSLENFYGNALNMNNFSHIIHKKESLKTWNWYKKLTKNQKLIPNIGGMTPTSGILFTKSVLSSMINLMINNPRQYDNMFSELRLGTLLQQSGYTLNKPFLNSESYINWNIDFITFDPSKFGYYHPIKTIV
Ga0208050_10003667F050320N/AMNTKVILFSHHKVDDLTIERFNNVKKLNPSWDVIPIGFKGYELMEGSIVTNKEKYPSNKDIQYFVPQYHLDWFDPDLFLYEGYVQKSNYNEYFLYEYDTISNVSIESFFDTNVDFFGNNLCVPARENWEWVELYRKHNPYNSYFKTLYAYGQSTCIYFKNHILSKCVNEVFTNKHLYDGMLSEVRGGTLASQFTTLKKGRHNIEKHISWTHKDITIDLSKPYFYHPVK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.