NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208050_1006858

Scaffold Ga0208050_1006858


Overview

Basic Information
Taxon OID3300020498 Open in IMG/M
Scaffold IDGa0208050_1006858 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1360
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.099444Long. (o)-89.404444Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000311Metagenome / Metatranscriptome1326Y
F000980Metagenome / Metatranscriptome814Y
F007470Metagenome / Metatranscriptome350Y
F042890Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0208050_10068581F042890AGGCGGMGDRANFGFVQPNGNTIVLYGHWAGHQMLANLAEAVIKAQGRWSDPSYATRITI
Ga0208050_10068583F007470GGAGMDYQDGFEDGVKFTREVIIANIRVWAEKSEDGAAYDDIADRLEFGTVDYDI
Ga0208050_10068584F000311GAGGMYFELTAPDRLSMEMAYWDAQMIGLDPTALSPLTFNIGTGSIEKVSRIRDKYNLTESYVSDYEPTGYTGR
Ga0208050_10068585F000980N/AVCTGDCDALIEYTIKDGFGWPAGEMNLTCRCNSNCTLLSVEDATIPYTDTPLPTKEEKMETTENVVPDTYNPNLLVTYKVIRGYSDAEYATDKVTSIEWDLHNARQAQKTNGVLNGKIDAVKEIICEAYADSQDQDTLREIAEALSIELIKEVEWTASIEVSGTYSYNILENDYDLDLESEITDAIFAESNNGNIEIGDQEVCNVREA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.