NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208091_1001354

Scaffold Ga0208091_1001354


Overview

Basic Information
Taxon OID3300020506 Open in IMG/M
Scaffold IDGa0208091_1001354 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3893
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (63.64%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F000852Metagenome / Metatranscriptome860Y
F001460Metagenome / Metatranscriptome690Y
F020171Metagenome / Metatranscriptome225Y

Sequences

Protein IDFamilyRBSSequence
Ga0208091_10013543F000852GGAMATKREYLKSQGITVGVRGRFSGAAKVALAEATTKGITFTAEKPVKKAK
Ga0208091_10013545F000263AGGMKTLYKDDELPSHLQRLVDAGVNGLDIMHGELKNLMLIAEEKLAWAQSIENETEEAMDSMERTKAEGRLDTLVELYKLTYDLSFAIGARNEA
Ga0208091_10013547F001460AGGAGMLGYTLDDLNRMTNAVHDAKLFYLRTPSDLMDKEPLRKDLEDAVSFMQGLWAEGYFD
Ga0208091_10013548F020171GGAGGMAGQFIDTVAEHITGAMIQEISEDLFENWSNACLDEGEDYAEYEFMSYASPDLKKQYNDFYGYTEGDDYYLC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.