NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208091_1003177

Scaffold Ga0208091_1003177


Overview

Basic Information
Taxon OID3300020506 Open in IMG/M
Scaffold IDGa0208091_1003177 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2376
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000332Metagenome / Metatranscriptome1283Y
F002933Metagenome / Metatranscriptome519Y
F058793Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
Ga0208091_10031773F002933GGAMIPPIHKWYPMVQPEGYPNRTDALERRAERLQEEYAQALKMRKVKDKIDDLEFELYVKKAERNQLSLEIFTNRKVDFYV
Ga0208091_10031774F000332AGAAGMRWLILLLLLVLVGATAKNGCQVSEFYNIAMSRHNPSERHQQLSIWLTNNAPHCKSQDLVIIWNNVPAWAGTADSAEIRSKIIQGYQDAIEREKK
Ga0208091_10031776F058793N/AMDPTQAQLNSHVDVCTLRYEMLCARIKRLENIMLGVSGIMLTSMAGIIFTSLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.