NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208202_1021728

Scaffold Ga0208202_1021728


Overview

Basic Information
Taxon OID3300020514 Open in IMG/M
Scaffold IDGa0208202_1021728 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 27AUG2008 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)744
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000263Metagenome / Metatranscriptome1424Y
F001460Metagenome / Metatranscriptome690Y
F007468Metagenome / Metatranscriptome350Y
F033037Metagenome / Metatranscriptome178Y

Sequences

Protein IDFamilyRBSSequence
Ga0208202_10217281F001460N/AESDLNRMINAIHDSKLFYLRTPSDLMDKTELRNDLEMAVSFMQGLWAEGYFDHTN
Ga0208202_10217282F007468GGAGGLTTQTKSSKFIEYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERVYG
Ga0208202_10217283F000263AGGMNSEDIGLPPHLQRLVNYDINGLDIMHGELKNLMLIWEKELENAQEAEDESGEAMDSMERTRCEGFLDALTALYQLTYQLSFAIAEKEKRDEARG
Ga0208202_10217284F033037AGGAGMKPGDKDKLNECLKILDTTDLGLSLVWLWTWSTINNIFEDETY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.