NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208234_1007287

Scaffold Ga0208234_1007287


Overview

Basic Information
Taxon OID3300020515 Open in IMG/M
Scaffold IDGa0208234_1007287 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 27SEP2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1438
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002387Metagenome / Metatranscriptome565Y
F007468Metagenome / Metatranscriptome350Y
F092053Metagenome / Metatranscriptome107N

Sequences

Protein IDFamilyRBSSequence
Ga0208234_10072871F092053AGGMKLSSEIKEDLQDQADQIIYFEAAMSNEDKASKAVYERLVEIYKVAFKEGAKSK
Ga0208234_10072872F007468GGAGGLTTQTKSSKFIEYMKIHLISLNQDLEGDYNVQSKINIQGQIMATEHLLSVATDIMNNSNERAYG
Ga0208234_10072874F002387GAGGMSDPYGTIGHYRKGGSIMASFLEDVNQMVIDAVYQDIAEQLLEDWINSNLDEGQYYADKQFAEMSGDEFIYDEFNKFYNLKEGDEDYLC
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.