NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208223_1000118

Scaffold Ga0208223_1000118


Overview

Basic Information
Taxon OID3300020519 Open in IMG/M
Scaffold IDGa0208223_1000118 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20175
Total Scaffold Genes59 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (47.46%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003331Metagenome / Metatranscriptome493Y
F007265Metagenome / Metatranscriptome354Y
F027748Metagenome / Metatranscriptome193Y

Sequences

Protein IDFamilyRBSSequence
Ga0208223_100011813F003331N/AMTLSEKAKIYYNVWCCAYQRRYNAKVKGDWELYDREHSTILMCLNMKGAEWVVFDSDRKKVN
Ga0208223_10001184F007265AGTAGGMISPYNVVPGTDIVHSITDVYELCDEVEGTTYRVELQADNGGVYIKSGEKRHEEGSKNITEDMSIANKELAIVVARRILELYGV
Ga0208223_100011842F027748N/AMSRLEMTYAQITAAHRYASDAREAICDLADHYSWETIAREMISRMTGDEALEFVEDFNSLYAN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.