NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208223_1008921

Scaffold Ga0208223_1008921


Overview

Basic Information
Taxon OID3300020519 Open in IMG/M
Scaffold IDGa0208223_1008921 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1649
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000714Metagenome / Metatranscriptome924Y
F001125Metagenome / Metatranscriptome769Y

Sequences

Protein IDFamilyRBSSequence
Ga0208223_10089211F001125GGCGGMGDRANFGFKDRKGDTIFLYGHWAGHRMLENLANAVEQARPRWSDESYATRICVSQLVNEEWASETGWGLNVNELGDNEHKVPIINWAEKTFTLMEEDLQAEVFSQSLDAFVSKYSSQPSMV
Ga0208223_10089215F000714N/ATYNPNLLVTYKVIRGYSDAEYATDKVTSIEWDLHNARQAQKTNGVYQDKINTVKDIITEAYADSDDQDTLRAIAEALGIELVREVLFTATLEVSGTYSYNVLDSDYELDLDSEVTDALYADSNNGNITIDDTEVCHVREA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.