NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208085_1000616

Scaffold Ga0208085_1000616


Overview

Basic Information
Taxon OID3300020526 Open in IMG/M
Scaffold IDGa0208085_1000616 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 21JUN2010 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)11680
Total Scaffold Genes42 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)21 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013631Metagenome / Metatranscriptome269Y
F053990Metagenome / Metatranscriptome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0208085_100061621F053990GGAMMYSSSQGGFKMIDTCILHDDYEDFAQKFLGVDYEDYISLQMGLPDEDELEIEYPVIA
Ga0208085_100061635F013631AGGALVDLNTVFNYTASRWDWQDGNVNQMWIQEIEESPDCYRYVAVAYNPRKDATMVMSEPRCYADTLNWVRKFCGSFCILPQYC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.