NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208232_1001485

Scaffold Ga0208232_1001485


Overview

Basic Information
Taxon OID3300020527 Open in IMG/M
Scaffold IDGa0208232_1001485 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4289
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (84.62%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F010760Metagenome / Metatranscriptome299Y
F032651Metagenome / Metatranscriptome179Y
F085611Metagenome / Metatranscriptome111Y

Sequences

Protein IDFamilyRBSSequence
Ga0208232_100148511F032651AGGAGMKVKVVNIEAAGYYTSEHASGSTVKVTLQRGKAIASCDEILIWDEEYAEDCFDEWRDCALAGEAGYTYTE
Ga0208232_10014852F085611GAGMNWELYEVWSVDEDGHEDLIDTTKSLKEARAIAEANLTDYYVECIVYAEDQEGELVEIERIK
Ga0208232_10014859F010760AGGAGMLNVDRIVKVYNGRCGCMCGCNGKYSYTADGAKNHGPGYDVTDSVNERSVRIIAKKILSNPNVEFESNYAFVEDRARNKMQMVVFKEQA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.