NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208487_1000317

Scaffold Ga0208487_1000317


Overview

Basic Information
Taxon OID3300020531 Open in IMG/M
Scaffold IDGa0208487_1000317 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)12195
Total Scaffold Genes37 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (75.68%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000325Metagenome / Metatranscriptome1296Y
F008812Metagenome / Metatranscriptome327Y
F012108Metagenome / Metatranscriptome283Y
F043359Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0208487_100031714F000325AGGAGMKVANGNDKLGKGCLVVSRPVGDTCPNSCAFLGNGCYAEQTEKIYPGVRPAGMQNLITERGRIRSMILDAMRQGKSIRWHERGDWFINGELDLDYVANVTWACESIIAEGKTLPDMWFYTHIYDDRLVSFEKYMNVYASIHNDEDMGAAMAQGFKKFAWCDSDQKIAPKRPRNKAKADAWRKALPKLVVLNGTKFVTCPEIRRGRGVVTCTPTKGSVSCDLCVRGLANVLFPSH
Ga0208487_100031719F008812AGGTGGMIQWIGVMFTLLGLLYTGVKDYQKGDIKIPAIQKPLTVQKYPIQYCLMAYDPNLDKVFYLHENGQWYDYAPQQRRYAASPQHYQTQNPQAVASAYGTQGTQANYVR
Ga0208487_100031722F043359GAGMEWNNSHKNPPEVGQKIYYFGPNIGIGIGHYSYEERIIVPYTYNEKNEKEYTDKEIELCPHIFTNLVFGVVDACDAPFWLPYDEERAKSWCPIIPEQYTKDLYD
Ga0208487_100031724F012108AGGAMINVPFTVREAMNLATNCDLVVYEKIVNAFEIALGVNQKCGVTITGGMTFDNRIPCIKAIRLHTGWGLKESKEWTDVLVGTWDDGGRRLKGASRHSLTLKTPEAAENLLRDLVGLGCEGFLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.