NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208487_1012472

Scaffold Ga0208487_1012472


Overview

Basic Information
Taxon OID3300020531 Open in IMG/M
Scaffold IDGa0208487_1012472 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 21SEP2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1095
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004723Metagenome / Metatranscriptome426Y
F024743Metagenome / Metatranscriptome204N
F047570Metagenome / Metatranscriptome149N

Sequences

Protein IDFamilyRBSSequence
Ga0208487_10124721F024743N/AMNEVELSNLYRETCGAYNKAKDAQDLIIMMNVLHLRLEHNMAYHKIAKRCGIKVN
Ga0208487_10124722F047570AGAAGMKMTNENKLKIVTLSHNIKALCYILDKKTFSEHCVTSGNFIEIDYLFDLAKKLKEINKEE
Ga0208487_10124723F004723AGTAGMEKFDKFIHTDILGKKHEVTYTGTRRIVKDCEFEFFVDDKGDSCFFTDTEVKKMEKKD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.