NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208601_1001873

Scaffold Ga0208601_1001873


Overview

Basic Information
Taxon OID3300020532 Open in IMG/M
Scaffold IDGa0208601_1001873 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3364
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001055Metagenome / Metatranscriptome791Y
F001298Metagenome / Metatranscriptome727Y
F001725Metagenome / Metatranscriptome645Y

Sequences

Protein IDFamilyRBSSequence
Ga0208601_10018732F001725N/AMAAISNGTTCVYGIAGTVTNLFVQSYSLSSSFNAEAMVINEAGITVTHRLDDRKSEITIEGIAKTGTVPVLGATLSFTVNTASAYPAGSATASFVGVVTKVDDKGSSQGFTSVSVTAVDFEGVSYT
Ga0208601_10018733F001055N/AMGTKSIRHIVEATLATYLSTQTGLTTVAFLTGDSAATQTLPKAVVLCESARAPADLPEGLGNYSCSVRITLFSNADDTTLADHRARCAALSGNMRDLTSIKAAFVTSTDAACYDVILTSEDEGIDERSWATAFAFDVLVVLPA
Ga0208601_10018735F001298N/AMSLYGTEFLNDAKEMVADFGVAGSANSGAITFSCLISDPAVSTVLEAGGYMERTQYSVRLPAVTASWSQPDGSMGASAALLSAGVPIASLAQGKKIVAGGKTVRITSQTYKPGSAWITLVVIDDNQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.