NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208601_1004232

Scaffold Ga0208601_1004232


Overview

Basic Information
Taxon OID3300020532 Open in IMG/M
Scaffold IDGa0208601_1004232 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2297
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000403Metagenome / Metatranscriptome1177Y
F000903Metagenome / Metatranscriptome843Y
F001897Metagenome / Metatranscriptome620Y

Sequences

Protein IDFamilyRBSSequence
Ga0208601_10042321F001897AGGCGGMAFMDNYEGNKERTDRWIATYPQGRLETLIVEFNAEKGYVLVQAKAFRNQLETEPAGVDYAHGFLAAYPDKMKRWMIEDTCTSALMRVMALVMGGTEKATKEVMAIVKTETPAADYDYWTTKHGDVPSYKTREEAEQAEPIAWEIPAESAPSCSHGSMRWNQSKPDAPKPWAGYFCNEKIKEKQCKPQWFVLTSDGTFKPQV
Ga0208601_10042322F000403GGTGGVSDYMEIINPQTRIAKVFFEGKVIAEYRVEQCDKCSKLMKFDQFGYQKGYDHTENIIWFCGGCR
Ga0208601_10042323F000903GGAGGMIDRIEEVQCMIAAISHCHDRSADHSSRIVKNLSWFEYVAQMGESMLAEMVVAKRLGYDYKPGITWDKSKADVGEHIEVKWSPNPNSNLWIQESDREDRDIAVLVTGNAPKMHIVGWMPVAVAKKPRYKNTSQNNWTVPQVNLQPIETLIRSNYAHPAI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.