NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208364_1000425

Scaffold Ga0208364_1000425


Overview

Basic Information
Taxon OID3300020533 Open in IMG/M
Scaffold IDGa0208364_1000425 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9845
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (72.22%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000635Metagenome / Metatranscriptome970Y
F002149Metagenome / Metatranscriptome589Y
F003112Metagenome / Metatranscriptome506N
F004760Metagenome / Metatranscriptome424N

Sequences

Protein IDFamilyRBSSequence
Ga0208364_100042514F000635AGGAMTLTEIAQYAGEKVGKTDSDTLTFLQKAASLAYRRVWDFAPWRETVTNSTYSVGTNRLITLGSNVETPLSVAYNDAEVDPIDLATIISQDPGLLDDGRTGDPDTYHFTGRNSSGVAELNLYPRLATSGTIPLRVVEKLKCLTRTNVIVDFPPSQAALDDELRLPHVHHLVLALTHSDALERERQYAKAQAITQTANSDLAAMANYELSQVGGIKQITPQSLGELTIEEMFSA
Ga0208364_100042516F002149N/AMTAVEYIEQSGVPEAMWPNLAEWFGWFEKQGMVGVVEDKDGIAGVALARCIKDGQEPNHYVHSEDGENVFVDLTISSKGAKSLRCLLLLLWERFGPRKRITFNRSGKPRSYCYMTFMRKARV
Ga0208364_10004253F004760AGGAMPVYQYEDTRNGKVVELEKAVAERDSVPRYLKRFTVPQRLSLVGVGEPLDNPLGVNQTNLMKGYYRQEQKLGSRFKSKYTPDSIKRVALRRK
Ga0208364_10004259F003112GAGMTGQEYACFKEALKFAVENNNMVKETKYIGKVKHLLSVNRSIKRIVEEGRDRDEVVDAVVHLAVSLRYLEGKGRES
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.