NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207942_1002343

Scaffold Ga0207942_1002343


Overview

Basic Information
Taxon OID3300020549 Open in IMG/M
Scaffold IDGa0207942_1002343 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3215
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (90.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameLake Mendota, Madison, Wisconsin, USA
CoordinatesLat. (o)43.098333Long. (o)-89.405278Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F055683Metagenome / Metatranscriptome138N
F064669Metagenome / Metatranscriptome128N
F099193Metagenome / Metatranscriptome103N

Sequences

Protein IDFamilyRBSSequence
Ga0207942_10023432F055683AGGAGMAQLNTVQDILQYAKAQQGITQQDTVGGSLYCELIDADQAEWFRKDLQEKVDSNTEVKMYALGKGVNRNRVEYVYDFVPQTETIPPEVEHMVELEAEIARGK
Ga0207942_10023433F064669AGAAGGMANSRALHPVEQWVQHITRTTPDLILGTLQHADLEMAQQLSHEMQLRGLTAADILRLKNRKQPVSTT
Ga0207942_10023434F099193GGAGGMYIQFDESRLKREFNEENLTAWAEYRAECHRANYYFKRDGWSEGTLWDWNPDKKECTLQLRWGDDQNNHEQYSHLEELDEQEYLRQYDEYVLSVKLTDLVS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.