Scaffold Ga0208855_1006934

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208855_1006934

Scaffold Ga0208855_1006934

Overview

Basic Information
Taxon OID	3300020553 Open in IMG/M
Scaffold ID	Ga0208855_1006934 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2001
Total Scaffold Genes	7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (14.29%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location Name	Lake Mendota, Madison, Wisconsin, USA
Coordinates	Lat. (^o)	43.098333	Long. (^o)	-89.405278	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025742	Metagenome / Metatranscriptome	200	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0208855_10069344	F025742	N/A	MLTIENENNIVGTELTGAGPDGPIAWHVSGIGKHLHHYIIYLTRDDNGWERKVKLDRYHSVNQTGIQYKLECGTEHMHLYRTSFLTIDIFKNYLEYFI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.